General Information

  • ID:  hor005289
  • Uniprot ID:  P31229
  • Protein name:  Pancreatic hormone
  • Gene name:  ppy
  • Organism:  Rana temporaria (European common frog)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rana (subgenus), Rana (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF
  • Length:  36(1-36)
  • Propeptide:  APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF
  • Signal peptide:  NA
  • Modification:  T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P31229-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P31229-F1.pdbhor005289_AF2.pdbhor005289_ESM.pdb

Physical Information

Mass: 486607 Formula: C192H275N51O59
Absent amino acids: CKMNW Common amino acids: Q
pI: 5.41 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -98.06 Boman Index: -8377
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 48.89
Instability Index: 3714.17 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  2091068
  • Title:  The complete primary structure of pancreatic polypeptide from the European common frog, Rana temporaria.